(data stored in ACNUC7421 zone)

EMBL: CP001349.PE206

CP001349.PE206       Location/Qualifiers
FT   CDS             complement(237159..239009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0213"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, pepF/M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: met:M446_3148 PepF/M3 family
FT                   oligoendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55258"
FT                   /db_xref="GOA:B8I9K5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR034013"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K5"
FT                   /inference="protein motif:TFAM:TIGR02290"
FT                   /protein_id="ACL55258.1"
FT                   /translation="MPTRAAAPSEAPQSAAQAMARAVDLGPLPEWDLSDLYAGLDDPAF
FT                   ARDLARAEAECRAFAEAYQGRIAALAAGDGASDRLGTAVAAYEALEDLMGRLLSFAGLV
FT                   YSGDTTDPARAKFYGDTQERLTAASSDLLFFTLELNRVPDEVLDAATALPPLARYRPWI
FT                   EDIRREKPHQLSDELERLLLEKSVTGRAAWNRLFDETVASLRFPVRGELLTLEPTLNKL
FT                   QDADEGLRRDAAEALSGVFRANLRLFTLITNTLAKDKEIADRWRRFGDVADSRHLANRV
FT                   EPEVVAALVEAVTAAYPRLSHRYYRLKARWFGRDSLAYWDRNAPLPKVEQRTIPWAEAR
FT                   ETVLSAYGAFSPRMAEIARTFFDGGWIDAPVRPGKAPGAFAHPTVPSSHPYVLVNYQGK
FT                   PRDVMTLAHELGHGVHQVLAAGNGALMAPTPLTLAETASVFGEMLTFRRVLDATTDRRQ
FT                   RRALLAAKVEDMINTVVRQIAFYVFERELHLARRAGELTADQICALWMSVQAESLGPAI
FT                   RLDAGYEPFWAYIPHFIHSPFYVYAYAFGDCLVNSLYGVYRNAEEGFVDRYFALLSAGG
FT                   SKPYGELLAPFGLDARDPSFWQIGLSMIEGMIAELEEMEA"
     MPTRAAAPSE APQSAAQAMA RAVDLGPLPE WDLSDLYAGL DDPAFARDLA RAEAECRAFA        60
     EAYQGRIAAL AAGDGASDRL GTAVAAYEAL EDLMGRLLSF AGLVYSGDTT DPARAKFYGD       120
     TQERLTAASS DLLFFTLELN RVPDEVLDAA TALPPLARYR PWIEDIRREK PHQLSDELER       180
     LLLEKSVTGR AAWNRLFDET VASLRFPVRG ELLTLEPTLN KLQDADEGLR RDAAEALSGV       240
     FRANLRLFTL ITNTLAKDKE IADRWRRFGD VADSRHLANR VEPEVVAALV EAVTAAYPRL       300
     SHRYYRLKAR WFGRDSLAYW DRNAPLPKVE QRTIPWAEAR ETVLSAYGAF SPRMAEIART       360
     FFDGGWIDAP VRPGKAPGAF AHPTVPSSHP YVLVNYQGKP RDVMTLAHEL GHGVHQVLAA       420
     GNGALMAPTP LTLAETASVF GEMLTFRRVL DATTDRRQRR ALLAAKVEDM INTVVRQIAF       480
     YVFERELHLA RRAGELTADQ ICALWMSVQA ESLGPAIRLD AGYEPFWAYI PHFIHSPFYV       540
     YAYAFGDCLV NSLYGVYRNA EEGFVDRYFA LLSAGGSKPY GELLAPFGLD ARDPSFWQIG       600
     LSMIEGMIAE LEEMEA                                                       616
//

If you have problems or comments...

PBIL Back to PBIL home page