(data stored in ACNUC7421 zone)

EMBL: CP001349.PE207

CP001349.PE207       Location/Qualifiers
FT   CDS             239290..240777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0214"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: met:M446_3149
FT                   two component, sigma54 specific, fis family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55259"
FT                   /db_xref="GOA:B8I9K6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL55259.1"
FT                   /translation="MSTTVLIVDDDPVQRRLAEAMVRRLGFEAIVAEGGEAALACLRAP
FT                   DAGIDVVLLDLVMPGGLDGLGVLAEMRRSAIDTPVIVQTANGSIDAVVTAMRAGAIDFV
FT                   VKPAGAERLQVSIKNALQVDQLQDEIRRMRRRASGALTFKDLTSKSPDMGRIIRLAERA
FT                   AKSNIPVLIEGESGVGKEVLARAIQGSGERRGKPFVTVNCGAIPDNLVESTLFGHEKGA
FT                   FTGATERHVGKFVEASGGTLFLDEIGELPLDAQVKLLRALQEGEVDPVGGRKSVRVDIR
FT                   LISATNRSLLDLVKQGRFREDLYYRLNVFPMTLPPLRARREDIPDLARSFCARFAAEEG
FT                   KRVRAITPEAMALITRYDWPGNVRQLENALFRAVVLADGDELTVAEFPQIAAQVEGFDV
FT                   RIPAAPSLPEAVAASAPLREIVRVEVRDPHAISLVSEESGEMKTMEGLEGEIIRYALQF
FT                   YRGRMSEVSRRLGIGRSTLYRKLKDLGIDEDKADDAA"
     MSTTVLIVDD DPVQRRLAEA MVRRLGFEAI VAEGGEAALA CLRAPDAGID VVLLDLVMPG        60
     GLDGLGVLAE MRRSAIDTPV IVQTANGSID AVVTAMRAGA IDFVVKPAGA ERLQVSIKNA       120
     LQVDQLQDEI RRMRRRASGA LTFKDLTSKS PDMGRIIRLA ERAAKSNIPV LIEGESGVGK       180
     EVLARAIQGS GERRGKPFVT VNCGAIPDNL VESTLFGHEK GAFTGATERH VGKFVEASGG       240
     TLFLDEIGEL PLDAQVKLLR ALQEGEVDPV GGRKSVRVDI RLISATNRSL LDLVKQGRFR       300
     EDLYYRLNVF PMTLPPLRAR REDIPDLARS FCARFAAEEG KRVRAITPEA MALITRYDWP       360
     GNVRQLENAL FRAVVLADGD ELTVAEFPQI AAQVEGFDVR IPAAPSLPEA VAASAPLREI       420
     VRVEVRDPHA ISLVSEESGE MKTMEGLEGE IIRYALQFYR GRMSEVSRRL GIGRSTLYRK       480
     LKDLGIDEDK ADDAA                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page