(data stored in ACNUC7421 zone)

EMBL: CP001349.PE208

CP001349.PE208       Location/Qualifiers
FT   CDS             240971..242983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0215"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: met:M446_3150
FT                   peptidoglycan binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55260"
FT                   /db_xref="GOA:B8I9K7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55260.1"
FT                   /translation="MLPRRRAAALVAVLMAGAASLAGARAQEAAPPASPPEAAAPTPPA
FT                   AAEAPVQATEPPAETAAPQAQPAEAPAQAAEASKPPLPDDPVAAAIATKLADSTVPLLR
FT                   RFGRREREALQAFYALGAFKPVWITDGAWTDAAKAVIARLGAAGEDGLDPLDYPIPTLG
FT                   IPTGSPADLAEADLKLSAAAALYARDARGGRIEPSRLSRLITPKLDLPSADAVLPRLAA
FT                   AGPGANAVLQSYNPSQTGYLALKAKLAALRSQRPGGVPMVRLPKGPTLKPGMRDARVPL
FT                   IRARFGLGPADDATAYDAAVAGAVERFQRERGLAATGILNPETVAALAGPSPGRQEADL
FT                   LANMERWRWLPADLGKTHVWVNIPEYKVRVVSGTRVVDEARVIVGKPDSPTPVFSGEMT
FT                   YAVVNPSWNVPPSILKNEFLPRLARDPTYAARLGYEVVRRGNGIAIRQPPGERNALGFI
FT                   KFMFPNDHAVYLHDTPNRALFARSARALSHGCVRVDDPFRFAEVVLGPTWPTERLKRLI
FT                   GKGERTVMLPEKLPVHLAYFTLVADEAGTLRQFDDLYGINARVKMALGLSNEPLPAPEV
FT                   SRKPKVKPAPAHSPPPHAPAPVPHAPTREARAARTAPAPAREARPARVVAQAPRRTRPV
FT                   ATAGQAVVQPAPDYYAPAPAYAPAPAPASSRFGWW"
     MLPRRRAAAL VAVLMAGAAS LAGARAQEAA PPASPPEAAA PTPPAAAEAP VQATEPPAET        60
     AAPQAQPAEA PAQAAEASKP PLPDDPVAAA IATKLADSTV PLLRRFGRRE REALQAFYAL       120
     GAFKPVWITD GAWTDAAKAV IARLGAAGED GLDPLDYPIP TLGIPTGSPA DLAEADLKLS       180
     AAAALYARDA RGGRIEPSRL SRLITPKLDL PSADAVLPRL AAAGPGANAV LQSYNPSQTG       240
     YLALKAKLAA LRSQRPGGVP MVRLPKGPTL KPGMRDARVP LIRARFGLGP ADDATAYDAA       300
     VAGAVERFQR ERGLAATGIL NPETVAALAG PSPGRQEADL LANMERWRWL PADLGKTHVW       360
     VNIPEYKVRV VSGTRVVDEA RVIVGKPDSP TPVFSGEMTY AVVNPSWNVP PSILKNEFLP       420
     RLARDPTYAA RLGYEVVRRG NGIAIRQPPG ERNALGFIKF MFPNDHAVYL HDTPNRALFA       480
     RSARALSHGC VRVDDPFRFA EVVLGPTWPT ERLKRLIGKG ERTVMLPEKL PVHLAYFTLV       540
     ADEAGTLRQF DDLYGINARV KMALGLSNEP LPAPEVSRKP KVKPAPAHSP PPHAPAPVPH       600
     APTREARAAR TAPAPAREAR PARVVAQAPR RTRPVATAGQ AVVQPAPDYY APAPAYAPAP       660
     APASSRFGWW                                                              670
//

If you have problems or comments...

PBIL Back to PBIL home page