(data stored in ACNUC7421 zone)

EMBL: CP001349.PE209

CP001349.PE209       Location/Qualifiers
FT   CDS             243210..244742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0216"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; protein of unknown function DUF882;
FT                   Peptidase M15A; KEGG: met:M446_3151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55261"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K8"
FT                   /inference="protein motif:PFAM:PF05951"
FT                   /protein_id="ACL55261.1"
FT                   /translation="MAAAVARQDAGAETIVRALLRTGCRTAATLREFRSRSADVPRLRP
FT                   SLRRAGLAAAAVAAALVGGTRGTQDAAANGDTRTLSIIHEHTKESATVTFKRDGRYDRA
FT                   ALEQLNWLLRDWRIDEPTKMDPRLFDVVWEAHRASGSRDAVHIVSAYRSPQTNAALRRR
FT                   SRAVAEHSQHMLGKAMDFFLTDVSVDQIREIGMRMQRGGVGWYPHAYNPFVHLDVGSVR
FT                   AWPRMSYDQLARLFPDGRTVHLPRDGRPLPGYEVAKAEILARGGSVLGYGQAVAALDEE
FT                   DSPSVVGQFFSMLFGGGSKPAPAPAPAPQAPPRVRPVALASAAPDDAGTRGALAYAAQP
FT                   DPRAALLRDASPPPAAPGPAAAGPAEPPAPSEAAAPLPPRRPAEFAALAEALAAAPLPP
FT                   ARPAAVQIASADPAALGPLLPPRSSRSPVAEAAAGDAKAQLRALFVAAADPAAPQGSAV
FT                   QLTQARTASRGTPPAGLVAAPAGDVALRFQPRGPEAVDAGRFSGSAVKPGSR"
     MAAAVARQDA GAETIVRALL RTGCRTAATL REFRSRSADV PRLRPSLRRA GLAAAAVAAA        60
     LVGGTRGTQD AAANGDTRTL SIIHEHTKES ATVTFKRDGR YDRAALEQLN WLLRDWRIDE       120
     PTKMDPRLFD VVWEAHRASG SRDAVHIVSA YRSPQTNAAL RRRSRAVAEH SQHMLGKAMD       180
     FFLTDVSVDQ IREIGMRMQR GGVGWYPHAY NPFVHLDVGS VRAWPRMSYD QLARLFPDGR       240
     TVHLPRDGRP LPGYEVAKAE ILARGGSVLG YGQAVAALDE EDSPSVVGQF FSMLFGGGSK       300
     PAPAPAPAPQ APPRVRPVAL ASAAPDDAGT RGALAYAAQP DPRAALLRDA SPPPAAPGPA       360
     AAGPAEPPAP SEAAAPLPPR RPAEFAALAE ALAAAPLPPA RPAAVQIASA DPAALGPLLP       420
     PRSSRSPVAE AAAGDAKAQL RALFVAAADP AAPQGSAVQL TQARTASRGT PPAGLVAAPA       480
     GDVALRFQPR GPEAVDAGRF SGSAVKPGSR                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page