(data stored in ACNUC7421 zone)

EMBL: CP001349.PE21

CP001349.PE21        Location/Qualifiers
FT   CDS             23879..24307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0022"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_0019 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55073"
FT                   /db_xref="GOA:B8IT11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT11"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55073.1"
FT                   /translation="MASVRGIEERASGVSTETSDQILNGARVLVVEDEAAISMLLEDML
FT                   LDFGCDIVGPAARLSTALEMAENETFAVAILDVNVAGEPIYPVAEAVVRRGLPLVFSTG
FT                   YGGAGIREPFRDRPVVQKPFSQQDLKRTLIAAIRGHSD"
     MASVRGIEER ASGVSTETSD QILNGARVLV VEDEAAISML LEDMLLDFGC DIVGPAARLS        60
     TALEMAENET FAVAILDVNV AGEPIYPVAE AVVRRGLPLV FSTGYGGAGI REPFRDRPVV       120
     QKPFSQQDLK RTLIAAIRGH SD                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page