(data stored in ACNUC7421 zone)

EMBL: CP001349.PE210

CP001349.PE210       Location/Qualifiers
FT   CDS             245210..246619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0218"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: met:M446_3159 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55262"
FT                   /db_xref="GOA:B8I9K9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K9"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL55262.1"
FT                   /translation="MTEIRHLDGAALLRRYRERSLSPREVVADVLSRTAAQEPAVNAFI
FT                   LADGEAALAAAAASEARWAAGAPCGPLDGLPVTIKDNIAWAGHPMRRGSRVSPETPLSE
FT                   NAPAVDRLLEAGAIPVGKTTMPEFGWKGLGDSTLTGITRNPWDLSRTTGGSSAGAAAAA
FT                   ALDLGLAHLGTDGAGSIRIPAAFCGVFGLKPSYGRVPAYPPSPFGPVAHLGPLARRVGD
FT                   AALMMRAIARPDARDMAAWLSEPPDYSAGLETGLRGLRVAWSPRLGFARQVDPEVAALT
FT                   AKAAAAFADLGAIVEEADPGFADPVETLNGIWLVGAWSVLRALPEDRRPEVEPALRAAA
FT                   ERGSRIAAPDFLAALNARAAVYTAMARFHARYDLLLTPSTAVAAFAAGHLTPPDGSYGE
FT                   DWLAWTPFSYPFNLTGQPAASVPCGLTRAGLPVGLQIVGPMGEDARVLAAARAFEAARP
FT                   WPVLDAPRQPT"
     MTEIRHLDGA ALLRRYRERS LSPREVVADV LSRTAAQEPA VNAFILADGE AALAAAAASE        60
     ARWAAGAPCG PLDGLPVTIK DNIAWAGHPM RRGSRVSPET PLSENAPAVD RLLEAGAIPV       120
     GKTTMPEFGW KGLGDSTLTG ITRNPWDLSR TTGGSSAGAA AAAALDLGLA HLGTDGAGSI       180
     RIPAAFCGVF GLKPSYGRVP AYPPSPFGPV AHLGPLARRV GDAALMMRAI ARPDARDMAA       240
     WLSEPPDYSA GLETGLRGLR VAWSPRLGFA RQVDPEVAAL TAKAAAAFAD LGAIVEEADP       300
     GFADPVETLN GIWLVGAWSV LRALPEDRRP EVEPALRAAA ERGSRIAAPD FLAALNARAA       360
     VYTAMARFHA RYDLLLTPST AVAAFAAGHL TPPDGSYGED WLAWTPFSYP FNLTGQPAAS       420
     VPCGLTRAGL PVGLQIVGPM GEDARVLAAA RAFEAARPWP VLDAPRQPT                   469
//

If you have problems or comments...

PBIL Back to PBIL home page