(data stored in ACNUC7421 zone)

EMBL: CP001349.PE211

CP001349.PE211       Location/Qualifiers
FT   CDS             246627..247130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0219"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   met:M446_3160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55263"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L0"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ACL55263.1"
FT                   /translation="MAPLGPAPRWLCDEMLARLARLLRAAGHDTALAASGMPDRAILET
FT                   AEREERLLLTRDRRLAAAAGARALLIPENDPEEQARHLARHCGIDWNLARFTRCLMDNA
FT                   LLREAPPEEIAALPLSTRAGPGPFRACPVCGRIYWPGSHVRRMLDRLDRLAAAAGTPDP
FT                   GGRS"
     MAPLGPAPRW LCDEMLARLA RLLRAAGHDT ALAASGMPDR AILETAEREE RLLLTRDRRL        60
     AAAAGARALL IPENDPEEQA RHLARHCGID WNLARFTRCL MDNALLREAP PEEIAALPLS       120
     TRAGPGPFRA CPVCGRIYWP GSHVRRMLDR LDRLAAAAGT PDPGGRS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page