(data stored in ACNUC7421 zone)

EMBL: CP001349.PE212

CP001349.PE212       Location/Qualifiers
FT   CDS             247258..248010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0220"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number="3.1.3.12"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: trehalose-phosphatase; KEGG: met:M446_3162 HAD family
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55264"
FT                   /db_xref="GOA:B8I9L1"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L1"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACL55264.1"
FT                   /translation="MTDTALALFLDFDGTLVDIAPRPDQVVVPAELPAALATLRGRLGG
FT                   ALAIVTGRPIATIDGFLAPERFDVGGLHGVEMRRGDRVAGCEPSAHPTLRAGVARLQDQ
FT                   TAPLEAVLIEDKGCSVAVHWRLATPTDARKAQDAVERLAADLGSAYRLQLGKAVGEILP
FT                   ATATKGHAIRAFQEDAPYAGRRAVFFGDDLTDEKAFATVNADGGVSVRIGGGETIAQHR
FT                   LAQPEDVRDLILRWAGGAPVDPEALPRA"
     MTDTALALFL DFDGTLVDIA PRPDQVVVPA ELPAALATLR GRLGGALAIV TGRPIATIDG        60
     FLAPERFDVG GLHGVEMRRG DRVAGCEPSA HPTLRAGVAR LQDQTAPLEA VLIEDKGCSV       120
     AVHWRLATPT DARKAQDAVE RLAADLGSAY RLQLGKAVGE ILPATATKGH AIRAFQEDAP       180
     YAGRRAVFFG DDLTDEKAFA TVNADGGVSV RIGGGETIAQ HRLAQPEDVR DLILRWAGGA       240
     PVDPEALPRA                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page