(data stored in ACNUC7421 zone)

EMBL: CP001349.PE213

CP001349.PE213       Location/Qualifiers
FT   CDS             248088..248510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0221"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   met:M446_3163 peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55265"
FT                   /db_xref="GOA:B8I9L2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L2"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACL55265.1"
FT                   /translation="MRLSPFLRAGALLIAMTAAASSADFTTTPSGLKYKDDVVGTGPAP
FT                   AAGQTVSVHYTGWLDEKGRKGKKFDSSVDRGQPLNFAVGTGQVIKGWDEGLSTMKVGGK
FT                   RTLVIPPDLGYGARGAGGVIPPNATLIFDVELLGVR"
     MRLSPFLRAG ALLIAMTAAA SSADFTTTPS GLKYKDDVVG TGPAPAAGQT VSVHYTGWLD        60
     EKGRKGKKFD SSVDRGQPLN FAVGTGQVIK GWDEGLSTMK VGGKRTLVIP PDLGYGARGA       120
     GGVIPPNATL IFDVELLGVR                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page