(data stored in ACNUC7421 zone)

EMBL: CP001349.PE214

CP001349.PE214       Location/Qualifiers
FT   CDS             complement(248673..249404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0222"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_3165 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55266"
FT                   /db_xref="GOA:B8I9L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55266.1"
FT                   /translation="MSAAPALPQAAPALLEVEDLHAYYGKSHILQGVSFHVGAGEIVAI
FT                   LGRNGVGRSTTLKAIMGDVAPRGTVRFKGRPIAGLKPHLVARRGLGYVPEERAIFPGLT
FT                   VRQNLALGEKAGAGARWTTADIFRLFPRLEERIDTPGGVLSGGEQQMLTICRTLMGNPD
FT                   LIMIDEPTEGLSPQMVARVGDLIAEIAARGVAVLLVEQKLTIALKLSQRLYVMGHGRMV
FT                   FEGTPAGLLENEAVRREWLEV"
     MSAAPALPQA APALLEVEDL HAYYGKSHIL QGVSFHVGAG EIVAILGRNG VGRSTTLKAI        60
     MGDVAPRGTV RFKGRPIAGL KPHLVARRGL GYVPEERAIF PGLTVRQNLA LGEKAGAGAR       120
     WTTADIFRLF PRLEERIDTP GGVLSGGEQQ MLTICRTLMG NPDLIMIDEP TEGLSPQMVA       180
     RVGDLIAEIA ARGVAVLLVE QKLTIALKLS QRLYVMGHGR MVFEGTPAGL LENEAVRREW       240
     LEV                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page