(data stored in ACNUC7421 zone)

EMBL: CP001349.PE215

CP001349.PE215       Location/Qualifiers
FT   CDS             complement(249401..250153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0223"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_3166 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55267"
FT                   /db_xref="GOA:B8I9L4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55267.1"
FT                   /translation="MTPPAVELSGVTKSFGATQIIAGVDLRVPAGERHAIIGPNGAGKS
FT                   TLFNLISGRLVPTSGTIRLEGADITGARPSVINRRGLARSFQVTNIFPRLSVWENVRCA
FT                   VLRAMGYRPLFWRSVERLPGVASRTAEILDSIRLGHRAAMPAGMLAYAEQRALEIGISI
FT                   ASDARVILLDEPMAGMSHSESEHATALIREVTQGRTLLMVEHDMAVVFGLADRISVLVY
FT                   GRLIATDTPERIRENRAVQEAYLGVAAA"
     MTPPAVELSG VTKSFGATQI IAGVDLRVPA GERHAIIGPN GAGKSTLFNL ISGRLVPTSG        60
     TIRLEGADIT GARPSVINRR GLARSFQVTN IFPRLSVWEN VRCAVLRAMG YRPLFWRSVE       120
     RLPGVASRTA EILDSIRLGH RAAMPAGMLA YAEQRALEIG ISIASDARVI LLDEPMAGMS       180
     HSESEHATAL IREVTQGRTL LMVEHDMAVV FGLADRISVL VYGRLIATDT PERIRENRAV       240
     QEAYLGVAAA                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page