(data stored in ACNUC7421 zone)

EMBL: CP001349.PE217

CP001349.PE217       Location/Qualifiers
FT   CDS             complement(251480..252433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0225"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_3168 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55269"
FT                   /db_xref="GOA:B8I9L6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55269.1"
FT                   /translation="MLELVIVSTLNGVLYGMLLFLMASGLTLIFSMMGVLNFAHASFYM
FT                   LGAFFGYQISRFAGFWVGLVVAPVLVGGLGALVERYGLRNVHRHGHVPELLFTFGLAYV
FT                   IEEVVQMIWGKLPLDYRVPALLDFPAFTIFDTNYPAYKLFMLLVSVVIFAGLLLVLTRT
FT                   RVGLIIQAALTHPNMVAMLGHDVAKVFMLVFGIGTGLAAVAGVIAGPALVTQSNMAGLL
FT                   GPILFVVVVVGGLGSLTGAFVASLLIGLIQTFAISLDVSIASLFEAFGIAAAPSGGVLG
FT                   DLWTVTIAQIGPVIPYLLLVIVLIFRPTGLLGSREA"
     MLELVIVSTL NGVLYGMLLF LMASGLTLIF SMMGVLNFAH ASFYMLGAFF GYQISRFAGF        60
     WVGLVVAPVL VGGLGALVER YGLRNVHRHG HVPELLFTFG LAYVIEEVVQ MIWGKLPLDY       120
     RVPALLDFPA FTIFDTNYPA YKLFMLLVSV VIFAGLLLVL TRTRVGLIIQ AALTHPNMVA       180
     MLGHDVAKVF MLVFGIGTGL AAVAGVIAGP ALVTQSNMAG LLGPILFVVV VVGGLGSLTG       240
     AFVASLLIGL IQTFAISLDV SIASLFEAFG IAAAPSGGVL GDLWTVTIAQ IGPVIPYLLL       300
     VIVLIFRPTG LLGSREA                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page