(data stored in ACNUC7421 zone)

EMBL: CP001349.PE218

CP001349.PE218       Location/Qualifiers
FT   CDS             complement(252543..253781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0226"
FT                   /product="ABC transporter, periplasmic branched chain amino
FT                   acid binding protein"
FT                   /note="KEGG: met:M446_3169 ABC transporter, periplasmic
FT                   branched chain amino acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55270"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L7"
FT                   /inference="similar to AA sequence:KEGG:M446_3169"
FT                   /protein_id="ACL55270.1"
FT                   /translation="MLRTIARTTAAGLLALAAGTALAAPATLRIAFIDPLSGGGASTGE
FT                   SGLKTFQYMAEQNNAKNPDLKLEVTGYDNKLNSQESLVQLQKAIDSGARIVVQGNGSSV
FT                   AAAIIDFVSKYNDRNPGKEVIYLNYAAVDPALTNAKCSYWHFRFDANSDIKMAALTSFI
FT                   KGKPEIKKVYLINQDYSFGQAVRAAARAMLKEKRPDIQIVGDEVAPLQKVNDFSPYIAK
FT                   IKASGADTVITGNWAQDMALLLKAAGDAGLQANFYTYYGGGTGGPTAIKQANLGDRVFQ
FT                   VAEGFANIPYPPGQDFERAFRARTGQELTYPRVVNLMNVLVKAADAAKSTDPKAIAKAM
FT                   ESIHNDTLYGQDSFMRPDDHQLFQTLYISQLGPVDTSKQFDSENTGWGWKAAGEVSAKD
FT                   TLLPTTCKMDRPS"
     MLRTIARTTA AGLLALAAGT ALAAPATLRI AFIDPLSGGG ASTGESGLKT FQYMAEQNNA        60
     KNPDLKLEVT GYDNKLNSQE SLVQLQKAID SGARIVVQGN GSSVAAAIID FVSKYNDRNP       120
     GKEVIYLNYA AVDPALTNAK CSYWHFRFDA NSDIKMAALT SFIKGKPEIK KVYLINQDYS       180
     FGQAVRAAAR AMLKEKRPDI QIVGDEVAPL QKVNDFSPYI AKIKASGADT VITGNWAQDM       240
     ALLLKAAGDA GLQANFYTYY GGGTGGPTAI KQANLGDRVF QVAEGFANIP YPPGQDFERA       300
     FRARTGQELT YPRVVNLMNV LVKAADAAKS TDPKAIAKAM ESIHNDTLYG QDSFMRPDDH       360
     QLFQTLYISQ LGPVDTSKQF DSENTGWGWK AAGEVSAKDT LLPTTCKMDR PS               412
//

If you have problems or comments...

PBIL Back to PBIL home page