(data stored in ACNUC7421 zone)

EMBL: CP001349.PE219

CP001349.PE219       Location/Qualifiers
FT   CDS             254049..254924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0227"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: met:M446_3170 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55271"
FT                   /db_xref="GOA:B8I9L8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L8"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL55271.1"
FT                   /translation="MSEAFATTRDPQRSRAAAWRDPALLDGEDGDRQFVTALARGLQVL
FT                   RAFKDATEMLGNREIAERTGLPKPTVSRLTHTLLTLGYLVHGEDGERYGLGPAVLALSA
FT                   AFLRQNSFPQMAKPYLQDLATAVQAHVALGLRDGLHSVYIQLWRGLGQTITLSREVGFH
FT                   LPLARSAMGMATLAGMDEEQRAPLVERLRAESGADWPRLEATMARCAAEVADHGFCVGI
FT                   GIWHPEINAVAAPVHSPGTRGLFAINVSGPAFLMTEAVLRRETGPKLLETIDRMRVLGI
FT                   VDEIPRRGGG"
     MSEAFATTRD PQRSRAAAWR DPALLDGEDG DRQFVTALAR GLQVLRAFKD ATEMLGNREI        60
     AERTGLPKPT VSRLTHTLLT LGYLVHGEDG ERYGLGPAVL ALSAAFLRQN SFPQMAKPYL       120
     QDLATAVQAH VALGLRDGLH SVYIQLWRGL GQTITLSREV GFHLPLARSA MGMATLAGMD       180
     EEQRAPLVER LRAESGADWP RLEATMARCA AEVADHGFCV GIGIWHPEIN AVAAPVHSPG       240
     TRGLFAINVS GPAFLMTEAV LRRETGPKLL ETIDRMRVLG IVDEIPRRGG G                291
//

If you have problems or comments...

PBIL Back to PBIL home page