(data stored in ACNUC7421 zone)

EMBL: CP001349.PE22

CP001349.PE22        Location/Qualifiers
FT   CDS             complement(24264..24503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55074"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT12"
FT                   /inference="similar to AA sequence:KEGG:M446_0020"
FT                   /protein_id="ACL55074.1"
FT                   /translation="MRSGFGCEACGSPAVRFPAVLHEDAPIQCDRCGCTLMAWGAFKRR
FT                   VEAETVRPDRARGDEAEAPAVSPNGPGSPRSGCA"
     MRSGFGCEAC GSPAVRFPAV LHEDAPIQCD RCGCTLMAWG AFKRRVEAET VRPDRARGDE        60
     AEAPAVSPNG PGSPRSGCA                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page