(data stored in ACNUC7421 zone)

EMBL: CP001349.PE220

CP001349.PE220       Location/Qualifiers
FT   CDS             255057..255815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0228"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_3175 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55272"
FT                   /db_xref="GOA:B8I9L9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55272.1"
FT                   /translation="MISADLRGRCVLVTGGASGIGLAAVTLFARNGAMVALNHLPDDPR
FT                   GPEAATRLADEGLAVMAVPGNVAVAGEAEDLVERSIAALGGLDVLINNAGTPGTHQPIA
FT                   FSDLDAMTEEFWQTILSTNLIGPYRCARAAAPALKTRRGAIVNTASVAGLGRRGSSIAY
FT                   SASKAGLVNLTRSLARALAPEIRVNAVAPGLVETPWTREWPPERKQATLARTLLARLAQ
FT                   PEDIAEAMLFLAAGAAYMTGETLVVDGGSD"
     MISADLRGRC VLVTGGASGI GLAAVTLFAR NGAMVALNHL PDDPRGPEAA TRLADEGLAV        60
     MAVPGNVAVA GEAEDLVERS IAALGGLDVL INNAGTPGTH QPIAFSDLDA MTEEFWQTIL       120
     STNLIGPYRC ARAAAPALKT RRGAIVNTAS VAGLGRRGSS IAYSASKAGL VNLTRSLARA       180
     LAPEIRVNAV APGLVETPWT REWPPERKQA TLARTLLARL AQPEDIAEAM LFLAAGAAYM       240
     TGETLVVDGG SD                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page