(data stored in ACNUC7421 zone)

EMBL: CP001349.PE221

CP001349.PE221       Location/Qualifiers
FT   CDS             255827..256708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0229"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   met:M446_3176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55273"
FT                   /db_xref="GOA:B8I9M0"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M0"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ACL55273.1"
FT                   /translation="MSRQTVITCALTGSFNTPSKNPAVPVSPKAIAQSALEAAGAGAAV
FT                   VHIHVRDPETAEPSMDLALYREVVERIRERNADVILNLTTGAGGRFVPGEDDPARPGPG
FT                   TSLASPEARTRHVTALRPEICTLDVATMNFGEHAFLNTPGHLRAMAARIAEAGTRPEIE
FT                   VFDLGQIELAKHLIAEGHLARPPLFQICLGIPWGAPATPETLLQMRDRLPPDAIWSAFG
FT                   ISRAEFPMVALAATAGGHVRVGLEDNLYLSRGQLAPSNAALVEKAATLLSLLDCVPATP
FT                   AEARALFGLAPR"
     MSRQTVITCA LTGSFNTPSK NPAVPVSPKA IAQSALEAAG AGAAVVHIHV RDPETAEPSM        60
     DLALYREVVE RIRERNADVI LNLTTGAGGR FVPGEDDPAR PGPGTSLASP EARTRHVTAL       120
     RPEICTLDVA TMNFGEHAFL NTPGHLRAMA ARIAEAGTRP EIEVFDLGQI ELAKHLIAEG       180
     HLARPPLFQI CLGIPWGAPA TPETLLQMRD RLPPDAIWSA FGISRAEFPM VALAATAGGH       240
     VRVGLEDNLY LSRGQLAPSN AALVEKAATL LSLLDCVPAT PAEARALFGL APR              293
//

If you have problems or comments...

PBIL Back to PBIL home page