(data stored in ACNUC7421 zone)

EMBL: CP001349.PE222

CP001349.PE222       Location/Qualifiers
FT   CDS             complement(256727..257140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0230"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   met:M446_3177 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55274"
FT                   /db_xref="GOA:B8I9M1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL55274.1"
FT                   /translation="MKKAPDPIDRHVGHRVRVRRLLVGVSQEKLGDALGVTFQQIQKYE
FT                   KGANRISASRLQQIAEMLGVPVGFFYEGAPRPENWLDEEHVEVARQPGSDLFWTSQDLQ
FT                   LVRAFQRVDDPQVRRRLVALVEALSGKDVAAQG"
     MKKAPDPIDR HVGHRVRVRR LLVGVSQEKL GDALGVTFQQ IQKYEKGANR ISASRLQQIA        60
     EMLGVPVGFF YEGAPRPENW LDEEHVEVAR QPGSDLFWTS QDLQLVRAFQ RVDDPQVRRR       120
     LVALVEALSG KDVAAQG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page