(data stored in ACNUC7421 zone)

EMBL: CP001349.PE223

CP001349.PE223       Location/Qualifiers
FT   CDS             complement(257161..258831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0231"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: met:M446_3178 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55275"
FT                   /db_xref="GOA:B8I9M2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M2"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACL55275.1"
FT                   /translation="MRPPDFDAPSFSAPSRLGAVADRIALASGWQRLALAWLAGACGAL
FT                   AMPPFGILPALAVALVPAVWLLDGAATGTGRLRRRLATAGSAAAIGWAWGFGYFVAGLW
FT                   WLGAAFLVEADQFAVLMPLGVLGLPAVLGLFFGLGFALARLLWSPGWARILALAAGLSA
FT                   AEWLRGHLFTGFPWNTLGMALGQNLWLMQAASVFGLYGLTLLAVLIGAAPATLATGATP
FT                   RARWTPPLLALAVLALLAGAGAWRIPAGPMPDVPGVRLRLVQANIPQDARFNPRNRDGI
FT                   LERYLGLSDSATAPESRGLADVTHLIWPESSFPFLIQRDPKALAQITAALPPGKHLVTG
FT                   AARADEPLPGERLHFYNGILVIGAEGFVGLPYDKHHLVPFGEYLPGPVDRILRAVGLRQ
FT                   FVAVPGGFTAAEGARRPFSVPGLPPVAASICYEVIFPGEVVPQVGARPGLILNLTNDGW
FT                   FGDTPGPRQHFAQARLRAVEEGLPLVRAANTGISAVADPYGRVTGFLPVGAEGVLDRKL
FT                   PRNLGESTFYSRFRDLFFAALLLGSVLLAIGARGRIARP"
     MRPPDFDAPS FSAPSRLGAV ADRIALASGW QRLALAWLAG ACGALAMPPF GILPALAVAL        60
     VPAVWLLDGA ATGTGRLRRR LATAGSAAAI GWAWGFGYFV AGLWWLGAAF LVEADQFAVL       120
     MPLGVLGLPA VLGLFFGLGF ALARLLWSPG WARILALAAG LSAAEWLRGH LFTGFPWNTL       180
     GMALGQNLWL MQAASVFGLY GLTLLAVLIG AAPATLATGA TPRARWTPPL LALAVLALLA       240
     GAGAWRIPAG PMPDVPGVRL RLVQANIPQD ARFNPRNRDG ILERYLGLSD SATAPESRGL       300
     ADVTHLIWPE SSFPFLIQRD PKALAQITAA LPPGKHLVTG AARADEPLPG ERLHFYNGIL       360
     VIGAEGFVGL PYDKHHLVPF GEYLPGPVDR ILRAVGLRQF VAVPGGFTAA EGARRPFSVP       420
     GLPPVAASIC YEVIFPGEVV PQVGARPGLI LNLTNDGWFG DTPGPRQHFA QARLRAVEEG       480
     LPLVRAANTG ISAVADPYGR VTGFLPVGAE GVLDRKLPRN LGESTFYSRF RDLFFAALLL       540
     GSVLLAIGAR GRIARP                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page