(data stored in ACNUC7421 zone)

EMBL: CP001349.PE224

CP001349.PE224       Location/Qualifiers
FT   CDS             complement(259265..260386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0232"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: met:M446_3179 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55276"
FT                   /db_xref="GOA:B8I9M3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M3"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACL55276.1"
FT                   /translation="MSNDRSRGAAATAQAAPDEDSPAREPWYDRLLTIFHLKPRETPRD
FT                   EITDALAEAQSGDHAFSPVERAMLKNVLSLHRVRVDDVMVPRADIVAVPDDISLGELLK
FT                   VFRTAGHSRLPVYGETLDDPRGMVHIRDFVDHLAARAEGGSGRGVKPAAEPPPVIQDDG
FT                   RARRPQLARTPSLCEVDLNATLASTRILRPVLFVPPSMPAIDLLVRMQASRTHMALVID
FT                   EYGGTDGLISIEDLVEVVVGDIEDEHDVAEGHRVLRVEGESEIYVADARASLDDVAEAT
FT                   GFDIAAAVGEMAEEVDTIGGLVVTITGRVPSRGEVIAVPGDFEVEVLDADPRRIKRLRL
FT                   HHGPAKLATSAEPLALPPPHTLNGTGAPADAGA"
     MSNDRSRGAA ATAQAAPDED SPAREPWYDR LLTIFHLKPR ETPRDEITDA LAEAQSGDHA        60
     FSPVERAMLK NVLSLHRVRV DDVMVPRADI VAVPDDISLG ELLKVFRTAG HSRLPVYGET       120
     LDDPRGMVHI RDFVDHLAAR AEGGSGRGVK PAAEPPPVIQ DDGRARRPQL ARTPSLCEVD       180
     LNATLASTRI LRPVLFVPPS MPAIDLLVRM QASRTHMALV IDEYGGTDGL ISIEDLVEVV       240
     VGDIEDEHDV AEGHRVLRVE GESEIYVADA RASLDDVAEA TGFDIAAAVG EMAEEVDTIG       300
     GLVVTITGRV PSRGEVIAVP GDFEVEVLDA DPRRIKRLRL HHGPAKLATS AEPLALPPPH       360
     TLNGTGAPAD AGA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page