(data stored in ACNUC7421 zone)

EMBL: CP001349.PE225

CP001349.PE225       Location/Qualifiers
FT   CDS             complement(260421..260900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0233"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   met:M446_3180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55277"
FT                   /db_xref="GOA:B8I9M4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M4"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACL55277.1"
FT                   /translation="MTNEIDVVVEDERWDRAVPDLGGFVRGAVEAALAVLPPGGPVEVS
FT                   VVLTDDAAVQELNRTWRGKDKPTNVLSFPAGHPHGGDLRPLGDVVLAYDTMLRESGEQS
FT                   KPLGHHLAHLLVHGTLHLLGQDHETGEAEAEAMEALEVVALRRLGVPDPYGDAAE"
     MTNEIDVVVE DERWDRAVPD LGGFVRGAVE AALAVLPPGG PVEVSVVLTD DAAVQELNRT        60
     WRGKDKPTNV LSFPAGHPHG GDLRPLGDVV LAYDTMLRES GEQSKPLGHH LAHLLVHGTL       120
     HLLGQDHETG EAEAEAMEAL EVVALRRLGV PDPYGDAAE                              159
//

If you have problems or comments...

PBIL Back to PBIL home page