(data stored in ACNUC7421 zone)

EMBL: CP001349.PE226

CP001349.PE226       Location/Qualifiers
FT   CDS             complement(260926..262035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0234"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: met:M446_3181 PhoH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55278"
FT                   /db_xref="GOA:B8I9M5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M5"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACL55278.1"
FT                   /translation="MRPGEASGRGGRTREAAARPVAGLSEAAEIAITFDDNRLASLVFG
FT                   QYDQNVAHLERRLDVLATALGNHVVVKGTPDAAERARLVLETLYARVRDGGGMPMTLGD
FT                   VDGVIQEVSLQGNLFPAAEAPANGERAQFEQIATRRRGAVRARNAAQDAYIKALRANEL
FT                   VFAEGPAGTGKTWLAVGHAVSLLEQGHAERLILSRPAVEAGERLGFLPGDMREKVDPYL
FT                   RPIYDALYDFMEARHVDRGLQTGMIEIAPLAFMRGRTLTNAVVLLDEAQNTTSMQMKMF
FT                   LTRLGENSRMIVTGDPSQIDLLPGQKSGLVEAVRILEGVEGIGRVIFKDADVVRHDLVR
FT                   RIVSAYEADARLTGEQPDSRPAPRRGPLP"
     MRPGEASGRG GRTREAAARP VAGLSEAAEI AITFDDNRLA SLVFGQYDQN VAHLERRLDV        60
     LATALGNHVV VKGTPDAAER ARLVLETLYA RVRDGGGMPM TLGDVDGVIQ EVSLQGNLFP       120
     AAEAPANGER AQFEQIATRR RGAVRARNAA QDAYIKALRA NELVFAEGPA GTGKTWLAVG       180
     HAVSLLEQGH AERLILSRPA VEAGERLGFL PGDMREKVDP YLRPIYDALY DFMEARHVDR       240
     GLQTGMIEIA PLAFMRGRTL TNAVVLLDEA QNTTSMQMKM FLTRLGENSR MIVTGDPSQI       300
     DLLPGQKSGL VEAVRILEGV EGIGRVIFKD ADVVRHDLVR RIVSAYEADA RLTGEQPDSR       360
     PAPRRGPLP                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page