(data stored in ACNUC7421 zone)

EMBL: CP001349.PE227

CP001349.PE227       Location/Qualifiers
FT   CDS             complement(262047..263390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0235"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: met:M446_3182 RNA modification protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55279"
FT                   /db_xref="GOA:B8I9M6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M6"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACL55279.1"
FT                   /translation="MKKAFVKSYGCQMNVYDAARMVDLLGREGFTETAVIEEADVVVLN
FT                   TCHIREKAAEKVYSELGRVRDLKGERAEAGRETTIVVAGCVAQAEGREIIHRAPAVDVV
FT                   VGPQSYHRLPDLLRRARAEKVVDTEFPIDDKFDHLPPRRIAGVSSFLTVQEGCDKFCAF
FT                   CVVPYTRGAEVSRPVAKVLAEAERLAAGGARELTLIGQNVNAYHGEGPDGATWSLGRLL
FT                   RRLAEVPGIARLRYTTSHPRDMDDDLIAAHRDCPALMPYLHLPVQSGSDRVLAAMNRKH
FT                   DAETYLRLIDRIRTARPDIALSSDFIVGFPGETDADHAATMRLVAEVGFASAFSFKYSP
FT                   RPGTPAAESADAVPEAVKRERLAELQALLEEQNRAFNRATIGRTVEVLFEKPGRHPGQV
FT                   AGKSPYLQAVQIEADPAVIGTVLPVRLTRPGSNSLFGERAEAAPAAAA"
     MKKAFVKSYG CQMNVYDAAR MVDLLGREGF TETAVIEEAD VVVLNTCHIR EKAAEKVYSE        60
     LGRVRDLKGE RAEAGRETTI VVAGCVAQAE GREIIHRAPA VDVVVGPQSY HRLPDLLRRA       120
     RAEKVVDTEF PIDDKFDHLP PRRIAGVSSF LTVQEGCDKF CAFCVVPYTR GAEVSRPVAK       180
     VLAEAERLAA GGARELTLIG QNVNAYHGEG PDGATWSLGR LLRRLAEVPG IARLRYTTSH       240
     PRDMDDDLIA AHRDCPALMP YLHLPVQSGS DRVLAAMNRK HDAETYLRLI DRIRTARPDI       300
     ALSSDFIVGF PGETDADHAA TMRLVAEVGF ASAFSFKYSP RPGTPAAESA DAVPEAVKRE       360
     RLAELQALLE EQNRAFNRAT IGRTVEVLFE KPGRHPGQVA GKSPYLQAVQ IEADPAVIGT       420
     VLPVRLTRPG SNSLFGERAE AAPAAAA                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page