(data stored in ACNUC7421 zone)

EMBL: CP001349.PE228

CP001349.PE228       Location/Qualifiers
FT   CDS             complement(263569..263973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55280"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M7"
FT                   /inference="similar to AA sequence:KEGG:M446_3183"
FT                   /protein_id="ACL55280.1"
FT                   /translation="MRMFRPALLGLLSLAALGAGTAVSEAQDSYVIRSYRGGQGLAIRV
FT                   RPRSWLDAGNVVEPNSGAVSNPATNPHFITASYLSSPPYIANRERWGGAGVLPDPITNG
FT                   PFIGARRAAVTVDLSGIDYLDPTSPLARGY"
     MRMFRPALLG LLSLAALGAG TAVSEAQDSY VIRSYRGGQG LAIRVRPRSW LDAGNVVEPN        60
     SGAVSNPATN PHFITASYLS SPPYIANRER WGGAGVLPDP ITNGPFIGAR RAAVTVDLSG       120
     IDYLDPTSPL ARGY                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page