(data stored in ACNUC7421 zone)

EMBL: CP001349.PE229

CP001349.PE229       Location/Qualifiers
FT   CDS             complement(264029..265036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55281"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M8"
FT                   /inference="similar to AA sequence:KEGG:M446_3184"
FT                   /protein_id="ACL55281.1"
FT                   /translation="MIGTSRGQLPAANRMARRLRLHGCAAIRSRPLHAFGGPVPLRDFD
FT                   DAALMRAGRALARDLGPADPVVPRPLPRAVRRRSWHPLRRSIGAAAVIALISILASERR
FT                   DVPPEAAAPLAPPPAWEAAAPDRYRLDGAEEARATARRRPGLGLREDSLALGTFGAVET
FT                   LFLRITLADAPDPETSLFVSLARRAAEHDGLAVIKTGDRGQVDSRFGPVETLEATLSGE
FT                   EGRRVCTAFRVIDATVRLDGWLCAPLGLLPEPVAVGCAIDRLTARPNVLLPAALVDLLT
FT                   RPARPVCAPPEPVAALVPRKSRDRKNAAKVRQSAQAWQDPGTTAALGRHPGTSR"
     MIGTSRGQLP AANRMARRLR LHGCAAIRSR PLHAFGGPVP LRDFDDAALM RAGRALARDL        60
     GPADPVVPRP LPRAVRRRSW HPLRRSIGAA AVIALISILA SERRDVPPEA AAPLAPPPAW       120
     EAAAPDRYRL DGAEEARATA RRRPGLGLRE DSLALGTFGA VETLFLRITL ADAPDPETSL       180
     FVSLARRAAE HDGLAVIKTG DRGQVDSRFG PVETLEATLS GEEGRRVCTA FRVIDATVRL       240
     DGWLCAPLGL LPEPVAVGCA IDRLTARPNV LLPAALVDLL TRPARPVCAP PEPVAALVPR       300
     KSRDRKNAAK VRQSAQAWQD PGTTAALGRH PGTSR                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page