(data stored in ACNUC7421 zone)

EMBL: CP001349.PE230

CP001349.PE230       Location/Qualifiers
FT   CDS             265366..266400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0238"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; KEGG: met:M446_3185
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55282"
FT                   /db_xref="GOA:B8I9M9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M9"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACL55282.1"
FT                   /translation="MGYKVAVVGATGNVGREMLDILAERAFPADTVVALASRRSLGQEV
FT                   SFGDKTLKVQALDQYDFSDTDICLMSAGGETSKEWSPRIGSQGCVVIDNSSAFRYDSDV
FT                   PLIVPEVNADAVVGFSKKNIIANPNCSTAQLVVALKPLHDAATIKRVVVATYQSVSGAG
FT                   KEAMDELFNQTRAVFTAGEVKVQKFTKRIAFNVIPHIDVFMEDGSTKEEWKMVAETKKM
FT                   LDPKIKLTATCVRVPVFIGHSEAVNVEFERPISAEEAREILRSAPGVLVDDKREPGGYI
FT                   TPHEAAGEDATYVSRIREDITVENGLSFWCVSDNLRKGAALNTVQIAEVLINRKLISPK
FT                   QKAA"
     MGYKVAVVGA TGNVGREMLD ILAERAFPAD TVVALASRRS LGQEVSFGDK TLKVQALDQY        60
     DFSDTDICLM SAGGETSKEW SPRIGSQGCV VIDNSSAFRY DSDVPLIVPE VNADAVVGFS       120
     KKNIIANPNC STAQLVVALK PLHDAATIKR VVVATYQSVS GAGKEAMDEL FNQTRAVFTA       180
     GEVKVQKFTK RIAFNVIPHI DVFMEDGSTK EEWKMVAETK KMLDPKIKLT ATCVRVPVFI       240
     GHSEAVNVEF ERPISAEEAR EILRSAPGVL VDDKREPGGY ITPHEAAGED ATYVSRIRED       300
     ITVENGLSFW CVSDNLRKGA ALNTVQIAEV LINRKLISPK QKAA                        344
//

If you have problems or comments...

PBIL Back to PBIL home page