(data stored in ACNUC7421 zone)

EMBL: CP001349.PE231

CP001349.PE231       Location/Qualifiers
FT   CDS             266492..268021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0239"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: met:M446_3186
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55283"
FT                   /db_xref="GOA:B8I9N0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N0"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL55283.1"
FT                   /translation="MAPTVLSVRDDLLAVLERLGIPAPFTGEGGVPARSPIDGLTIGHL
FT                   HETTDAEAEAAIGRAAEVFLAWRRVPAPRRGELVRLLGEELRAAKADLGRLVMLETGKI
FT                   LSEGLGEVQEMIDICDFAVGLSRQLHGLTIATERPDHRMMEVWHPLGPCGVITAFNFPV
FT                   AVWSWNAALALVCGDPVLWKPSEKTPLTALAVQAIAGRALKRFGAEAPEGLLQVLIGGR
FT                   SLGERLAADPRIPLVSATGSTAMGRQVAPVLAARFARAILELGGNNAAIVAASADLDLA
FT                   LRAVAFAAMGTAGQRCTTLRRLFVQESIYDAFLPRLRTAYASVRIGDPRDPATLVGPLI
FT                   DLSAADGMARALDEARALGATIQGGERLSDIRGDAAAYLRPALVEMRTQAGPMLRETFA
FT                   PILYVVPYRELDEAIAAQNAVAAGLSSSIFTRDLSEAEIFLSVAGSDCGIANVNIGPSG
FT                   AEIGGAFGGEKATGGGREAGSDSWKAYMRRATNTINYGKSLPLAQGVSFEL"
     MAPTVLSVRD DLLAVLERLG IPAPFTGEGG VPARSPIDGL TIGHLHETTD AEAEAAIGRA        60
     AEVFLAWRRV PAPRRGELVR LLGEELRAAK ADLGRLVMLE TGKILSEGLG EVQEMIDICD       120
     FAVGLSRQLH GLTIATERPD HRMMEVWHPL GPCGVITAFN FPVAVWSWNA ALALVCGDPV       180
     LWKPSEKTPL TALAVQAIAG RALKRFGAEA PEGLLQVLIG GRSLGERLAA DPRIPLVSAT       240
     GSTAMGRQVA PVLAARFARA ILELGGNNAA IVAASADLDL ALRAVAFAAM GTAGQRCTTL       300
     RRLFVQESIY DAFLPRLRTA YASVRIGDPR DPATLVGPLI DLSAADGMAR ALDEARALGA       360
     TIQGGERLSD IRGDAAAYLR PALVEMRTQA GPMLRETFAP ILYVVPYREL DEAIAAQNAV       420
     AAGLSSSIFT RDLSEAEIFL SVAGSDCGIA NVNIGPSGAE IGGAFGGEKA TGGGREAGSD       480
     SWKAYMRRAT NTINYGKSLP LAQGVSFEL                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page