(data stored in ACNUC7421 zone)

EMBL: CP001349.PE232

CP001349.PE232       Location/Qualifiers
FT   CDS             complement(268333..269355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0240"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: mlo:mlr6069 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55284"
FT                   /db_xref="GOA:B8I9N1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55284.1"
FT                   /translation="MGEYIGLDVSLKETALSVRRDGKRVWRGRCASDPAVIARVLRKHA
FT                   PEAQRIVFETGPLSVWFYHALRAEGLPAICIDARHAKAALDMAANKTDANDADGLAHLA
FT                   EVGFFREVRVKGYDSLLVRTLVAARSKLVQVTTELSNQIRGLMKTFGLIVPGAKGGSFE
FT                   AEVRRLLSGDHGLARVILPLLEAWNAVRRRAAELGRQLLAGARQSQACQRLMAIPGIGA
FT                   ITATAFVTAIEDPANFRSSRSVAAWFGLTTRRYQSGEVDYDGHISRRGDAHMRGLLYEA
FT                   ATVLLTRSQVDSDLRAWGLKLRERLGFKRAAVAVARKLAVVMHAMLKSGHSYRAKAAMA
FT                   "
     MGEYIGLDVS LKETALSVRR DGKRVWRGRC ASDPAVIARV LRKHAPEAQR IVFETGPLSV        60
     WFYHALRAEG LPAICIDARH AKAALDMAAN KTDANDADGL AHLAEVGFFR EVRVKGYDSL       120
     LVRTLVAARS KLVQVTTELS NQIRGLMKTF GLIVPGAKGG SFEAEVRRLL SGDHGLARVI       180
     LPLLEAWNAV RRRAAELGRQ LLAGARQSQA CQRLMAIPGI GAITATAFVT AIEDPANFRS       240
     SRSVAAWFGL TTRRYQSGEV DYDGHISRRG DAHMRGLLYE AATVLLTRSQ VDSDLRAWGL       300
     KLRERLGFKR AAVAVARKLA VVMHAMLKSG HSYRAKAAMA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page