(data stored in ACNUC7421 zone)

EMBL: CP001349.PE233

CP001349.PE233       Location/Qualifiers
FT   CDS             269915..270835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55285"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N2"
FT                   /inference="similar to AA sequence:KEGG:Bind_2168"
FT                   /protein_id="ACL55285.1"
FT                   /translation="MVNVVQQWNPDDWESFALSLLQVRHGILNVQKVPATHRGDFGIDF
FT                   YCTAASVIYQCFAVEEPVDVVARATRQKNKITTDLRKLVDGAVEVSQLFLGVPVKKWIL
FT                   LVPLHDSKDVNLHCAKKTTDTRALQLAHLDTDFEVCVHDQGAFPGAALSAAISALTNLS
FT                   LSVQAPTQKELEEWQAGSPNLLANATKKLSKRTAPGGVQDAVVSGVELFLKGNALVDAL
FT                   RSSAPDLHEKVVAAISGRARRLSYVGPQGGPAPNNIMNTELNTLINAIKDAAPTLSQAN
FT                   AEDIALGTLSDWIMRCPLDFPSNGS"
     MVNVVQQWNP DDWESFALSL LQVRHGILNV QKVPATHRGD FGIDFYCTAA SVIYQCFAVE        60
     EPVDVVARAT RQKNKITTDL RKLVDGAVEV SQLFLGVPVK KWILLVPLHD SKDVNLHCAK       120
     KTTDTRALQL AHLDTDFEVC VHDQGAFPGA ALSAAISALT NLSLSVQAPT QKELEEWQAG       180
     SPNLLANATK KLSKRTAPGG VQDAVVSGVE LFLKGNALVD ALRSSAPDLH EKVVAAISGR       240
     ARRLSYVGPQ GGPAPNNIMN TELNTLINAI KDAAPTLSQA NAEDIALGTL SDWIMRCPLD       300
     FPSNGS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page