(data stored in ACNUC7421 zone)

EMBL: CP001349.PE234

CP001349.PE234       Location/Qualifiers
FT   CDS             270825..271313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55286"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N3"
FT                   /inference="similar to AA sequence:KEGG:Bind_2169"
FT                   /protein_id="ACL55286.1"
FT                   /translation="MAADNFFRQAIEGATFSFTARPEPVAGDLRMSWGIGVLLLSLFYA
FT                   RGKKGSFPKLQFLAHAIRTQEGREDVRALMAGRLRTTDISVRVEPWLNRAVSYAHGLGF
FT                   VDVTKGKSVGLTEKGREVAAALDADKSVFKEERAFLAEVTKKLTEAQLTKIWRMEDLL"
     MAADNFFRQA IEGATFSFTA RPEPVAGDLR MSWGIGVLLL SLFYARGKKG SFPKLQFLAH        60
     AIRTQEGRED VRALMAGRLR TTDISVRVEP WLNRAVSYAH GLGFVDVTKG KSVGLTEKGR       120
     EVAAALDADK SVFKEERAFL AEVTKKLTEA QLTKIWRMED LL                          162
//

If you have problems or comments...

PBIL Back to PBIL home page