(data stored in ACNUC7421 zone)

EMBL: CP001349.PE235

CP001349.PE235       Location/Qualifiers
FT   CDS             271310..273355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55287"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2170"
FT                   /protein_id="ACL55287.1"
FT                   /translation="MTLRLRHLRMRAMTSAGLYGTDIGFELGLNVIWADNTKGKSTCMQ
FT                   GMLYALGLEKMLSPRREVPLPHAMTSFLRNDDETTATILESGVSLEIQNGAGTIVTVHR
FT                   PVKKAGVDNRLISVDFGPTLTDPEARPERRDFFVLDAGAAQREDGFHRFLEDFLGWQLP
FT                   IVRRYDSPEGKLYLETIFPLFWVEQKAGWSSIPAAIPTYLRIREVQKRAVEFIMDLNIH
FT                   KLELERQRLQERIDQNARDWRNLWDEIDRYARRSGGKTDALPQRPTIVPNELAKGHVLI
FT                   AEKGSWVSLKDMLAQLRGRVAELNGVPVPAVGTSVDHLERQLEALGKEVEGVNRARIEV
FT                   HKAKQLKEADIGSLERRIRSLADDMQKNQDVQKFQRYSGTARSLTPDYCPTCEQALVDS
FT                   LMSQKVLTAIMPIEDNIEYIRSQMKMFDDILKREQEEMSKIEIRTAQVDRDLNELYSRI
FT                   RTVRTDLIAPTGNPSAVAIEERVRTEARIRELETIQATFDDTVARMQTLASAFGDLLLA
FT                   VADLPKDKMSPLDRSKFDTLTALLRQLAREFGFSTFDASELTIDEDTYRPQKEGYEIGF
FT                   ETSASDAIRLKWAYQLGLLELSHRHPTHHPGMLLLDEPRQQSSSRVSFGSLLERAATHQ
FT                   RVDQQIIISTSEDLEMLKEILSRITCKDTIIPGYVIKPVSVTGSVH"
     MTLRLRHLRM RAMTSAGLYG TDIGFELGLN VIWADNTKGK STCMQGMLYA LGLEKMLSPR        60
     REVPLPHAMT SFLRNDDETT ATILESGVSL EIQNGAGTIV TVHRPVKKAG VDNRLISVDF       120
     GPTLTDPEAR PERRDFFVLD AGAAQREDGF HRFLEDFLGW QLPIVRRYDS PEGKLYLETI       180
     FPLFWVEQKA GWSSIPAAIP TYLRIREVQK RAVEFIMDLN IHKLELERQR LQERIDQNAR       240
     DWRNLWDEID RYARRSGGKT DALPQRPTIV PNELAKGHVL IAEKGSWVSL KDMLAQLRGR       300
     VAELNGVPVP AVGTSVDHLE RQLEALGKEV EGVNRARIEV HKAKQLKEAD IGSLERRIRS       360
     LADDMQKNQD VQKFQRYSGT ARSLTPDYCP TCEQALVDSL MSQKVLTAIM PIEDNIEYIR       420
     SQMKMFDDIL KREQEEMSKI EIRTAQVDRD LNELYSRIRT VRTDLIAPTG NPSAVAIEER       480
     VRTEARIREL ETIQATFDDT VARMQTLASA FGDLLLAVAD LPKDKMSPLD RSKFDTLTAL       540
     LRQLAREFGF STFDASELTI DEDTYRPQKE GYEIGFETSA SDAIRLKWAY QLGLLELSHR       600
     HPTHHPGMLL LDEPRQQSSS RVSFGSLLER AATHQRVDQQ IIISTSEDLE MLKEILSRIT       660
     CKDTIIPGYV IKPVSVTGSV H                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page