(data stored in ACNUC7421 zone)

EMBL: CP001349.PE237

CP001349.PE237       Location/Qualifiers
FT   CDS             complement(273510..274676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0245"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: met:M446_3187
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55289"
FT                   /db_xref="GOA:B8I9N6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N6"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACL55289.1"
FT                   /translation="MPVINRVAALTDEITAWRRDFHQHPELLFAVDRTAGLVAERLRAF
FT                   GCDEVVTGLGRTGVVGVIRGRRGGSGRTIGLRADMDALPIEEATEVPYRSAIPGKMHAC
FT                   GHDGHTAMLLGAAKYLAETRNFDGTAVVIFQPAEEGGGGGDAMVKDGLMERFGIQEVYG
FT                   LHNKPGLPLGHFAIRPGPIMAAVDRFTITIEGRGGHAAQPQECVDTVLISAHVITALQS
FT                   IVARNADPVASAVVSVTTMRAGEAFNVLPQTAVLNGTVRSLTEPVRRLCEERIGALAAG
FT                   IASAFGATAQTSYSRGYPVTDNHPDQAAFMADVAAEVAGEEGVDRAVDPMMGAEDFSYM
FT                   LEQRPGAYIFLGTGDGPGLHHPAYDFNDAATPYGVSLWARLIERAMPA"
     MPVINRVAAL TDEITAWRRD FHQHPELLFA VDRTAGLVAE RLRAFGCDEV VTGLGRTGVV        60
     GVIRGRRGGS GRTIGLRADM DALPIEEATE VPYRSAIPGK MHACGHDGHT AMLLGAAKYL       120
     AETRNFDGTA VVIFQPAEEG GGGGDAMVKD GLMERFGIQE VYGLHNKPGL PLGHFAIRPG       180
     PIMAAVDRFT ITIEGRGGHA AQPQECVDTV LISAHVITAL QSIVARNADP VASAVVSVTT       240
     MRAGEAFNVL PQTAVLNGTV RSLTEPVRRL CEERIGALAA GIASAFGATA QTSYSRGYPV       300
     TDNHPDQAAF MADVAAEVAG EEGVDRAVDP MMGAEDFSYM LEQRPGAYIF LGTGDGPGLH       360
     HPAYDFNDAA TPYGVSLWAR LIERAMPA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page