(data stored in ACNUC7421 zone)

EMBL: CP001349.PE238

CP001349.PE238       Location/Qualifiers
FT   CDS             275040..275918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0246"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: met:M446_3188 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55290"
FT                   /db_xref="GOA:B8I9N7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N7"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACL55290.1"
FT                   /translation="MSETIEIRSGSTRAAIALHGAEPVSWQVEGNEYLWSGDPAHWNRH
FT                   APWLFPVVGASAGGEVFVAGRRHPMPQHGFARDSRFTVVEQAPDRVRLRLTETPETLTR
FT                   FPFRFRLDIAARVEAGRLAFACEVANTDTAPLPYALGFHPAFPWPFAGGERRAGGGYAV
FT                   RFAQAERPAAPEVGPGGLLLRTERSVPLDGDTLPLDPALFTEALVFLNAQSRSLRFTAP
FT                   SGAAIRLEAEDFPHLAVWTKPTAPFLSLECWTGHADWAEFSGDLAERDSQRLLAPGTSA
FT                   RHGVVLAFEAA"
     MSETIEIRSG STRAAIALHG AEPVSWQVEG NEYLWSGDPA HWNRHAPWLF PVVGASAGGE        60
     VFVAGRRHPM PQHGFARDSR FTVVEQAPDR VRLRLTETPE TLTRFPFRFR LDIAARVEAG       120
     RLAFACEVAN TDTAPLPYAL GFHPAFPWPF AGGERRAGGG YAVRFAQAER PAAPEVGPGG       180
     LLLRTERSVP LDGDTLPLDP ALFTEALVFL NAQSRSLRFT APSGAAIRLE AEDFPHLAVW       240
     TKPTAPFLSL ECWTGHADWA EFSGDLAERD SQRLLAPGTS ARHGVVLAFE AA               292
//

If you have problems or comments...

PBIL Back to PBIL home page