(data stored in ACNUC7421 zone)

EMBL: CP001349.PE239

CP001349.PE239       Location/Qualifiers
FT   CDS             276057..277025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0247"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: met:M446_3189 integrase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55291"
FT                   /db_xref="GOA:B8I9N8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9N8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL55291.1"
FT                   /translation="MLQTTPPDLLLGAPDLREAAAAWLAVLKTERRFSENTVEAYGRDL
FT                   RQFLAHLARSGAAPDIPALVALKPRDLRAFMAARRAEGVSGRSLMRALAALRSFARHLD
FT                   REGHGTVSALSAVRSPKVERRLPRPLPVAAAVAMASPDIRAGEDRPDWVLARDAAVLAL
FT                   LYGAGLRIGEALGIRRKDAPVGDIDTLTILGKGQKTRMVPVIAPVQAAVADYLAVCPHP
FT                   LPPDGPLFVGQKGGPLSPRIVQLAVASLRGALGLPDSATPHALRHSFATHLLARQGDLR
FT                   AIQDLLGHASLATTQVYTKVDSARLLSAFDAAHPRAGRPGG"
     MLQTTPPDLL LGAPDLREAA AAWLAVLKTE RRFSENTVEA YGRDLRQFLA HLARSGAAPD        60
     IPALVALKPR DLRAFMAARR AEGVSGRSLM RALAALRSFA RHLDREGHGT VSALSAVRSP       120
     KVERRLPRPL PVAAAVAMAS PDIRAGEDRP DWVLARDAAV LALLYGAGLR IGEALGIRRK       180
     DAPVGDIDTL TILGKGQKTR MVPVIAPVQA AVADYLAVCP HPLPPDGPLF VGQKGGPLSP       240
     RIVQLAVASL RGALGLPDSA TPHALRHSFA THLLARQGDL RAIQDLLGHA SLATTQVYTK       300
     VDSARLLSAF DAAHPRAGRP GG                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page