(data stored in ACNUC7421 zone)

EMBL: CP001349.PE24

CP001349.PE24        Location/Qualifiers
FT   CDS             complement(24967..25920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0025"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: met:M446_0022
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55076"
FT                   /db_xref="GOA:B8IT14"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT14"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACL55076.1"
FT                   /translation="MSDRADDPPRRPDAPGRGPAVYTAFGLAAEAEPLAPGLHVVATPI
FT                   GNLKDVTFRALGTLAAADAVLAEDTRVTRTLLAHYGITTPLVSYHEHSGEAVRERMVAR
FT                   MKAGEALALVSDAGTPLVSDPGFKLVQAAIAAGLSVTPVPGPSAAITALMAAGLPTDRF
FT                   FFEGFLPQKAGARRNRLAALASVPGTLVLFEAPHRLPEMLADAAEMLGGGRSAAVAREL
FT                   TKLFETVRRGDLASLAAEFAASGPPKGEVVVVIGAAVEGAPGPEADADLDARLTAALAR
FT                   HSIKDAAALVADETGQKRRDVYARALALTRRADDED"
     MSDRADDPPR RPDAPGRGPA VYTAFGLAAE AEPLAPGLHV VATPIGNLKD VTFRALGTLA        60
     AADAVLAEDT RVTRTLLAHY GITTPLVSYH EHSGEAVRER MVARMKAGEA LALVSDAGTP       120
     LVSDPGFKLV QAAIAAGLSV TPVPGPSAAI TALMAAGLPT DRFFFEGFLP QKAGARRNRL       180
     AALASVPGTL VLFEAPHRLP EMLADAAEML GGGRSAAVAR ELTKLFETVR RGDLASLAAE       240
     FAASGPPKGE VVVVIGAAVE GAPGPEADAD LDARLTAALA RHSIKDAAAL VADETGQKRR       300
     DVYARALALT RRADDED                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page