(data stored in ACNUC7421 zone)

EMBL: CP001349.PE240

CP001349.PE240       Location/Qualifiers
FT   CDS             complement(277345..278172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0248"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   met:M446_2362 helix-turn-helix domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55292"
FT                   /db_xref="GOA:B8I9N9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N9"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACL55292.1"
FT                   /translation="MLGPDQRRDLGAFVRSHRERLRPDLPTGRRRTPGLRREELAARAG
FT                   ISATWCAWIEQGRDVQVSAQALDRLAAALALTRAERAYLFELAGRRDPQAARPEPVADA
FT                   PASLRDAVAALDHPAYGLDRLWNACCWNAAAARLFRGWLDGEGERNLLRFVFLDPAARR
FT                   LIPAWEERARRVIAEFRADYGHSRADPRARALVEELRRASPRFAAIWDEQDVRDRTGGL
FT                   RRFLHPEDGPVAYIQHSFAATDRPDYKLILLVPVGRDDTGARSGENRLALDEP"
     MLGPDQRRDL GAFVRSHRER LRPDLPTGRR RTPGLRREEL AARAGISATW CAWIEQGRDV        60
     QVSAQALDRL AAALALTRAE RAYLFELAGR RDPQAARPEP VADAPASLRD AVAALDHPAY       120
     GLDRLWNACC WNAAAARLFR GWLDGEGERN LLRFVFLDPA ARRLIPAWEE RARRVIAEFR       180
     ADYGHSRADP RARALVEELR RASPRFAAIW DEQDVRDRTG GLRRFLHPED GPVAYIQHSF       240
     AATDRPDYKL ILLVPVGRDD TGARSGENRL ALDEP                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page