(data stored in ACNUC7421 zone)

EMBL: CP001349.PE241

CP001349.PE241       Location/Qualifiers
FT   CDS             278254..279036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0249"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: met:M446_2361
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55293"
FT                   /db_xref="GOA:B8I9P0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55293.1"
FT                   /translation="MDRSHETPVSHETLVTAQFGPRAAAYVESAVHASGEDLAALDAIV
FT                   ARAAPRRALDLGCGGGHVAYRLARHAQAVTASDLSAEMLAAVAATAQARGLTAIETVEA
FT                   AAERLPFADASFDFIASRFSAHHWRDVEGGLREARRVAQTGAPAVFIDGCSPGSPLLDT
FT                   HLQAVELLRDPSHVRDYSASEWTGALARCGFVIEACLTWRVRMEFSSWIARMQTPETHV
FT                   RAIRALQTLASEPVRAHFAIEPDGSFLLDVLMVEARAA"
     MDRSHETPVS HETLVTAQFG PRAAAYVESA VHASGEDLAA LDAIVARAAP RRALDLGCGG        60
     GHVAYRLARH AQAVTASDLS AEMLAAVAAT AQARGLTAIE TVEAAAERLP FADASFDFIA       120
     SRFSAHHWRD VEGGLREARR VAQTGAPAVF IDGCSPGSPL LDTHLQAVEL LRDPSHVRDY       180
     SASEWTGALA RCGFVIEACL TWRVRMEFSS WIARMQTPET HVRAIRALQT LASEPVRAHF       240
     AIEPDGSFLL DVLMVEARAA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page