(data stored in ACNUC7421 zone)

EMBL: CP001349.PE242

CP001349.PE242       Location/Qualifiers
FT   CDS             complement(279197..280309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0250"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: met:M446_2360 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55294"
FT                   /db_xref="GOA:B8I9P1"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P1"
FT                   /inference="protein motif:PFAM:PF00925"
FT                   /protein_id="ACL55294.1"
FT                   /translation="MSLTVTNVDERLRREQVQVERAIAEMRAGRAVAILGEEPALAVSA
FT                   ESVDARLAADWERLGTAVRLVLPAPRLRRIGLANRFEAGAVALPVVDPARITALALKVD
FT                   GRIDAPVACARRVDAVALELARLAQVIPAMVVAPVSGVPEDALTVDPAAVELFRTRQAA
FT                   ALRIVSRAPVPLDGAPETEFVVFRGGEGLRDQVAVVVGRPNLAEPVAVRVHSACLTGDL
FT                   FGSLKCDCGDQLRGTARWMAGNGGGIILYLDQEGRGNGLANKIRAYDLQAKGFDTYAAD
FT                   AALGFGLDQRRFDFAAAMLRCLGVGAVRVLSNNPEKIAALAEAGLTVVGAQRAPGRVTP
FT                   ENARYLAAKRDIAGHVLELGGFSCAEVSGG"
     MSLTVTNVDE RLRREQVQVE RAIAEMRAGR AVAILGEEPA LAVSAESVDA RLAADWERLG        60
     TAVRLVLPAP RLRRIGLANR FEAGAVALPV VDPARITALA LKVDGRIDAP VACARRVDAV       120
     ALELARLAQV IPAMVVAPVS GVPEDALTVD PAAVELFRTR QAAALRIVSR APVPLDGAPE       180
     TEFVVFRGGE GLRDQVAVVV GRPNLAEPVA VRVHSACLTG DLFGSLKCDC GDQLRGTARW       240
     MAGNGGGIIL YLDQEGRGNG LANKIRAYDL QAKGFDTYAA DAALGFGLDQ RRFDFAAAML       300
     RCLGVGAVRV LSNNPEKIAA LAEAGLTVVG AQRAPGRVTP ENARYLAAKR DIAGHVLELG       360
     GFSCAEVSGG                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page