(data stored in ACNUC7421 zone)

EMBL: CP001349.PE243

CP001349.PE243       Location/Qualifiers
FT   CDS             280361..281128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0251"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: met:M446_2359 deaminase-reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55295"
FT                   /db_xref="GOA:B8I9P2"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P2"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACL55295.1"
FT                   /translation="MKAGVDYATEGWTPAQPWPGHSADVATDGNSATLFAPLADGSCDQ
FT                   PFVIAQLGQSLDGRIATLSGDSKYINRGAALDHLHRLRAHVDAIVVGIGTVLADDPRLT
FT                   VRRVAGRSPARIVIDPAGRIPAQAQCLREDGVRRIVVCRPDTRIPACAEALRIEAPEAF
FT                   PPQALVSALGRLGFRRILIEGGARTISGFIDAGAIDRLHLMVAPLLLGSGRHGLDLRPI
FT                   AALHEAMRPLTRCYPLCDGDVLFDCDLRRCAEP"
     MKAGVDYATE GWTPAQPWPG HSADVATDGN SATLFAPLAD GSCDQPFVIA QLGQSLDGRI        60
     ATLSGDSKYI NRGAALDHLH RLRAHVDAIV VGIGTVLADD PRLTVRRVAG RSPARIVIDP       120
     AGRIPAQAQC LREDGVRRIV VCRPDTRIPA CAEALRIEAP EAFPPQALVS ALGRLGFRRI       180
     LIEGGARTIS GFIDAGAIDR LHLMVAPLLL GSGRHGLDLR PIAALHEAMR PLTRCYPLCD       240
     GDVLFDCDLR RCAEP                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page