(data stored in ACNUC7421 zone)

EMBL: CP001349.PE244

CP001349.PE244       Location/Qualifiers
FT   CDS             281148..281690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0252"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: met:M446_2358
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55296"
FT                   /db_xref="GOA:B8I9P3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P3"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACL55296.1"
FT                   /translation="MTPTRYSSVQKFLHWTIALLIFGLVPVAITMTNIGEGELQNRLFE
FT                   LHKSTGLTVLALALARILVRAARGAPALVAGLPAWQRKAARASHYALYGLIVLVPVLGW
FT                   AGTSACCAPVKWFGLFSLTLPISGGMPVGEAILKVHMAVASLLVLLVFIHIGAALHHHV
FT                   IRRDATLRRMLPGRSEV"
     MTPTRYSSVQ KFLHWTIALL IFGLVPVAIT MTNIGEGELQ NRLFELHKST GLTVLALALA        60
     RILVRAARGA PALVAGLPAW QRKAARASHY ALYGLIVLVP VLGWAGTSAC CAPVKWFGLF       120
     SLTLPISGGM PVGEAILKVH MAVASLLVLL VFIHIGAALH HHVIRRDATL RRMLPGRSEV       180
//

If you have problems or comments...

PBIL Back to PBIL home page