(data stored in ACNUC7421 zone)

EMBL: CP001349.PE245

CP001349.PE245       Location/Qualifiers
FT   CDS             complement(282155..282397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55297"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P4"
FT                   /inference="similar to AA sequence:KEGG:M446_2356"
FT                   /protein_id="ACL55297.1"
FT                   /translation="MSAADHTAKLIRMANQIATFFHPYPEEEAVASVATHIRDFWTPKM
FT                   REALAAYCTDDGKGVDPLVLKAVEAERGRAEPQAA"
     MSAADHTAKL IRMANQIATF FHPYPEEEAV ASVATHIRDF WTPKMREALA AYCTDDGKGV        60
     DPLVLKAVEA ERGRAEPQAA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page