(data stored in ACNUC7421 zone)

EMBL: CP001349.PE246

CP001349.PE246       Location/Qualifiers
FT   CDS             complement(282394..283293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0254"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: met:M446_2355 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55298"
FT                   /db_xref="GOA:B8I9P5"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P5"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACL55298.1"
FT                   /translation="MRKTSPSPASPNGSMPPSSGGEAAADTAIRVPTQVVAYGDPQARA
FT                   DTRPLAVEMPVNVIYGSVPYAVMMTTPADLVDFAYGFSLTEGIVRGADEIRGAAVEPGE
FT                   GGLRLVVDLAPGRLREHLARKRAMSGRTGCGVCGIDDLADIPKAETRPDAGVRVTMAAV
FT                   ERALSALYDLQILNRETRAVHAAAWADLDGRILAVREDVGRHNALDKLIGALLRAGTDP
FT                   AQGFLVITSRCSFEMAEKAASFGASVLVAISAPTSLAVERAKAHGLTLAAIARSDTVTV
FT                   FTGAERLLLAPDHPEETP"
     MRKTSPSPAS PNGSMPPSSG GEAAADTAIR VPTQVVAYGD PQARADTRPL AVEMPVNVIY        60
     GSVPYAVMMT TPADLVDFAY GFSLTEGIVR GADEIRGAAV EPGEGGLRLV VDLAPGRLRE       120
     HLARKRAMSG RTGCGVCGID DLADIPKAET RPDAGVRVTM AAVERALSAL YDLQILNRET       180
     RAVHAAAWAD LDGRILAVRE DVGRHNALDK LIGALLRAGT DPAQGFLVIT SRCSFEMAEK       240
     AASFGASVLV AISAPTSLAV ERAKAHGLTL AAIARSDTVT VFTGAERLLL APDHPEETP        299
//

If you have problems or comments...

PBIL Back to PBIL home page