(data stored in ACNUC7421 zone)

EMBL: CP001349.PE247

CP001349.PE247       Location/Qualifiers
FT   CDS             complement(283238..286096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0255"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; 4Fe-4S ferredoxin, iron-sulphur binding,
FT                   conserved site; KEGG: mrd:Mrad2831_4998 formate
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55299"
FT                   /db_xref="GOA:B8I9P6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P6"
FT                   /inference="protein motif:TFAM:TIGR01591"
FT                   /protein_id="ACL55299.1"
FT                   /translation="MALIKEIDYGTPIRVAEKTVTLTIDGESVTVPAGTSVMAAAMTAG
FT                   TQIPKLCATDSLEPFGSCRLCLVEIEGRRGTPASCTTPAEDGMVVHTQTDRLAKLRKGV
FT                   MELYISDHPLDCLTCAANGDCELQDMAGAVGLREVRYEEGADHFKKSSDLYLPKDESNP
FT                   YFTYDPAKCIVCNRCVRACEEVQGTFALTIAGRGFDSRVAAGPTNFFESECVSCGACVQ
FT                   ACPTATLQEKSIIAHGQPEHSAVTTCAYCGVGCAFKAEMQGTRVVRMVPYKDGKANEGH
FT                   SCVKGRFAYGYAAHKDRITKPMIRKKITDPWREVSWEEAIAYAASEFKRIQDSFGRDAV
FT                   GGITSSRCTNEEAYLVQKLVRAAFGNNNVDTCARVCHSPTGYGLKTTLGTSAGTQDFKS
FT                   VDEADVILVVGANPTDGHPVFGSRMKKRLRQGAKLIVADPRRIDLVKSPHIKADYHLPL
FT                   KPGSNVAFVNAMAHVIVTEGLVDEAYVRERCDLADFEVWARFVADERHAPEMVGPMIGV
FT                   DPADLRAAARLYATGGAAAIYYGLGVTEHSQGSTMVMGLANLAMATGNIGKPGAGVNPL
FT                   RGQNNVQGSCDMGSFPHELSGYRHVSDDATRETFESLWGATLSAEPGLRITNMLDEAVG
FT                   GGFKGLYIQGEDIAQSDPDTHHVTAGLRAMECIVIQDLFLNETAKYAHVFLPGASFLEK
FT                   DGTFTNAERRISRVRKVMPPLGGYADWEGTMLLSNALGYPMHYTHPSEIMDEIAQLTPS
FT                   FAGVSYARLDELGSIQWPCNAEAPEGTPMMHVDRFVRGLGKFMITEYVPTDERTTAKYP
FT                   LILTTGRILSQYNVGAQTRRTHNSRWHEEDVLEIHPFDAESRGIVDGDLVALESRSGDI
FT                   ALKARVTERMQPGIVYTTFHHAKTGANVITTDYSDWATNCPEYKVTAVQVRRTNRPSDW
FT                   QARFYEEDVSLTRIAQRLDAAE"
     MALIKEIDYG TPIRVAEKTV TLTIDGESVT VPAGTSVMAA AMTAGTQIPK LCATDSLEPF        60
     GSCRLCLVEI EGRRGTPASC TTPAEDGMVV HTQTDRLAKL RKGVMELYIS DHPLDCLTCA       120
     ANGDCELQDM AGAVGLREVR YEEGADHFKK SSDLYLPKDE SNPYFTYDPA KCIVCNRCVR       180
     ACEEVQGTFA LTIAGRGFDS RVAAGPTNFF ESECVSCGAC VQACPTATLQ EKSIIAHGQP       240
     EHSAVTTCAY CGVGCAFKAE MQGTRVVRMV PYKDGKANEG HSCVKGRFAY GYAAHKDRIT       300
     KPMIRKKITD PWREVSWEEA IAYAASEFKR IQDSFGRDAV GGITSSRCTN EEAYLVQKLV       360
     RAAFGNNNVD TCARVCHSPT GYGLKTTLGT SAGTQDFKSV DEADVILVVG ANPTDGHPVF       420
     GSRMKKRLRQ GAKLIVADPR RIDLVKSPHI KADYHLPLKP GSNVAFVNAM AHVIVTEGLV       480
     DEAYVRERCD LADFEVWARF VADERHAPEM VGPMIGVDPA DLRAAARLYA TGGAAAIYYG       540
     LGVTEHSQGS TMVMGLANLA MATGNIGKPG AGVNPLRGQN NVQGSCDMGS FPHELSGYRH       600
     VSDDATRETF ESLWGATLSA EPGLRITNML DEAVGGGFKG LYIQGEDIAQ SDPDTHHVTA       660
     GLRAMECIVI QDLFLNETAK YAHVFLPGAS FLEKDGTFTN AERRISRVRK VMPPLGGYAD       720
     WEGTMLLSNA LGYPMHYTHP SEIMDEIAQL TPSFAGVSYA RLDELGSIQW PCNAEAPEGT       780
     PMMHVDRFVR GLGKFMITEY VPTDERTTAK YPLILTTGRI LSQYNVGAQT RRTHNSRWHE       840
     EDVLEIHPFD AESRGIVDGD LVALESRSGD IALKARVTER MQPGIVYTTF HHAKTGANVI       900
     TTDYSDWATN CPEYKVTAVQ VRRTNRPSDW QARFYEEDVS LTRIAQRLDA AE               952
//

If you have problems or comments...

PBIL Back to PBIL home page