(data stored in ACNUC7421 zone)

EMBL: CP001349.PE248

CP001349.PE248       Location/Qualifiers
FT   CDS             complement(286107..287666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0256"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; KEGG: met:M446_2353 NADH dehydrogenase
FT                   (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55300"
FT                   /db_xref="GOA:B8I9P7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P7"
FT                   /inference="protein motif:PFAM:PF01512"
FT                   /protein_id="ACL55300.1"
FT                   /translation="MSVTIFVPRDAVAVGLGAERVVTALTRGAASRNLDIRIVRTGSRG
FT                   MVWLEPMVEVATPEGRIAYGPVRPGDVESLLDAGLAEGGAHRLRIGRPEEHPFLARQQR
FT                   LTFHRCGVVDPVSVADYRAHGGYRGLARALEIGPADTVDAVKVSGLRGRGGAGFPTGIK
FT                   WNTVMLAEADQKYVVCNADEGDSGTFADRMLMEGDPFTLIEGMTIAGVAVGATRGYIYL
FT                   RSEYPNAYQILKTAIAAGERAGVLGRNILGSGKDFFLEVRLGAGAYICGEETSLLESLE
FT                   GKRGIVRAKPPIPALKGLFGRPTLVNNVLSFAAVPWILEHGGEAYANYGMGRSRGTLPI
FT                   QLAGNVKYGGLIETAFGITLRAVIEDFGGGSLSGRPVRAAQVGGPLGAYFPDVLFDTPM
FT                   DYEAFAARKGLVGHGGVVVFDDTVDMARQARFAFEFCAVESCGKCTPCRIGAVRGRETM
FT                   ERLLAGEAPAEPLRLIEDLCEVMTDGSLCAMGGLTPVPVMSAITHFPEDFDRSSRLPLA
FT                   AE"
     MSVTIFVPRD AVAVGLGAER VVTALTRGAA SRNLDIRIVR TGSRGMVWLE PMVEVATPEG        60
     RIAYGPVRPG DVESLLDAGL AEGGAHRLRI GRPEEHPFLA RQQRLTFHRC GVVDPVSVAD       120
     YRAHGGYRGL ARALEIGPAD TVDAVKVSGL RGRGGAGFPT GIKWNTVMLA EADQKYVVCN       180
     ADEGDSGTFA DRMLMEGDPF TLIEGMTIAG VAVGATRGYI YLRSEYPNAY QILKTAIAAG       240
     ERAGVLGRNI LGSGKDFFLE VRLGAGAYIC GEETSLLESL EGKRGIVRAK PPIPALKGLF       300
     GRPTLVNNVL SFAAVPWILE HGGEAYANYG MGRSRGTLPI QLAGNVKYGG LIETAFGITL       360
     RAVIEDFGGG SLSGRPVRAA QVGGPLGAYF PDVLFDTPMD YEAFAARKGL VGHGGVVVFD       420
     DTVDMARQAR FAFEFCAVES CGKCTPCRIG AVRGRETMER LLAGEAPAEP LRLIEDLCEV       480
     MTDGSLCAMG GLTPVPVMSA ITHFPEDFDR SSRLPLAAE                              519
//

If you have problems or comments...

PBIL Back to PBIL home page