(data stored in ACNUC7421 zone)

EMBL: CP001349.PE249

CP001349.PE249       Location/Qualifiers
FT   CDS             complement(287663..288136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0257"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: met:M446_2352 NADH dehydrogenase
FT                   (ubiquinone) 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55301"
FT                   /db_xref="GOA:B8I9P8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P8"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACL55301.1"
FT                   /translation="MPGYEPWSGARAARIIAEHTHLEGATLPILHALQETFGYVDNEAI
FT                   PLIADALNLSKAEVHGCITFYHDFRAKPAGRHVVKLCRAEACQAVGADALHAEVLRRLE
FT                   VDWHGTTRDGAVTVEPVFCLGLCACGPAALIDGEPVARLDADGLQAALTEVAA"
     MPGYEPWSGA RAARIIAEHT HLEGATLPIL HALQETFGYV DNEAIPLIAD ALNLSKAEVH        60
     GCITFYHDFR AKPAGRHVVK LCRAEACQAV GADALHAEVL RRLEVDWHGT TRDGAVTVEP       120
     VFCLGLCACG PAALIDGEPV ARLDADGLQA ALTEVAA                                157
//

If you have problems or comments...

PBIL Back to PBIL home page