(data stored in ACNUC7421 zone)

EMBL: CP001349.PE25

CP001349.PE25        Location/Qualifiers
FT   CDS             26098..27294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0026"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_0023 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55077"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT15"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55077.1"
FT                   /translation="MAAMRFGRRGRLAASMVLALGLAACGGGVSPVVATRPVVEAPAPP
FT                   AGDAATIGAGSVKVALILPLTGPGAAAGTAMRNAAELAVQEFQNPDLKILVKDDRGSPE
FT                   GAREAASAAVAEGAELVIGPLFAGSVQGAAATARAAGKPVIAFSTDASVAARGVYLLSF
FT                   LPQPEVDRVVDEVTAAGRRSFAALIPETTYGHVVEAQFREAVARKGGRVVALERYPAGN
FT                   PAAAVGRLAPLITGPGAQADVLFLPDAPEGLAGTAGALTRAGFNPTRVKPIGTAIWNDP
FT                   RVFALPALQGGWFAAVDPGGYANFAQRYRTRFGTEPVRVASLAYDAVSLAAALNRQYGS
FT                   QRFAEPTLTNPSGFAGVDGTFRFRAEGTSERALAVFEIRGAAAAVVSPAPRALGPSGT"
     MAAMRFGRRG RLAASMVLAL GLAACGGGVS PVVATRPVVE APAPPAGDAA TIGAGSVKVA        60
     LILPLTGPGA AAGTAMRNAA ELAVQEFQNP DLKILVKDDR GSPEGAREAA SAAVAEGAEL       120
     VIGPLFAGSV QGAAATARAA GKPVIAFSTD ASVAARGVYL LSFLPQPEVD RVVDEVTAAG       180
     RRSFAALIPE TTYGHVVEAQ FREAVARKGG RVVALERYPA GNPAAAVGRL APLITGPGAQ       240
     ADVLFLPDAP EGLAGTAGAL TRAGFNPTRV KPIGTAIWND PRVFALPALQ GGWFAAVDPG       300
     GYANFAQRYR TRFGTEPVRV ASLAYDAVSL AAALNRQYGS QRFAEPTLTN PSGFAGVDGT       360
     FRFRAEGTSE RALAVFEIRG AAAAVVSPAP RALGPSGT                               398
//

If you have problems or comments...

PBIL Back to PBIL home page