(data stored in ACNUC7421 zone)

EMBL: CP001349.PE250

CP001349.PE250       Location/Qualifiers
FT   CDS             288426..288824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0258"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: met:M446_2351 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55302"
FT                   /db_xref="GOA:B8I9P9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P9"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACL55302.1"
FT                   /translation="MLTGGCYCGRVRFAADAPAFHETVCHCASCRRAVGAASVAWLSVK
FT                   RASFRLTAGEPIRFRSSPGVTRSFCGTCGTSLTYEAEAYPDELDLTIASLDDPDAVPPK
FT                   DHTQAAERLRWTSLADGLPVHPRTRPGR"
     MLTGGCYCGR VRFAADAPAF HETVCHCASC RRAVGAASVA WLSVKRASFR LTAGEPIRFR        60
     SSPGVTRSFC GTCGTSLTYE AEAYPDELDL TIASLDDPDA VPPKDHTQAA ERLRWTSLAD       120
     GLPVHPRTRP GR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page