(data stored in ACNUC7421 zone)

EMBL: CP001349.PE251

CP001349.PE251       Location/Qualifiers
FT   CDS             complement(288959..289867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0259"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2350 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55303"
FT                   /db_xref="GOA:B8I9Q0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55303.1"
FT                   /translation="MIDRLEFILALAREQHFGRAAQACGVSQQTLSAGVKQLEERLGVM
FT                   LVQRGSRFQGFTPEGERVLEWARRIVGDARAMRQEVAALRRGLSGTLRMAAVPTATPVV
FT                   AALTTPFRARHPAVRFSVQSATSHEIIRQIANLELDAGLTYLENEPLGRVTMVPLYREQ
FT                   YRLLTAADGIYGGRDSVTWAEVAHIPLCLLTPNMQNRRIIDRQLRAVGAEPAPILESNS
FT                   MIVLVTHVRTAKWASIMPAALAETFRLTERVRAVPITDPDVSHTIGLVVPDRDPMTPLV
FT                   AAFLAEARAIAPHLENDLAAL"
     MIDRLEFILA LAREQHFGRA AQACGVSQQT LSAGVKQLEE RLGVMLVQRG SRFQGFTPEG        60
     ERVLEWARRI VGDARAMRQE VAALRRGLSG TLRMAAVPTA TPVVAALTTP FRARHPAVRF       120
     SVQSATSHEI IRQIANLELD AGLTYLENEP LGRVTMVPLY REQYRLLTAA DGIYGGRDSV       180
     TWAEVAHIPL CLLTPNMQNR RIIDRQLRAV GAEPAPILES NSMIVLVTHV RTAKWASIMP       240
     AALAETFRLT ERVRAVPITD PDVSHTIGLV VPDRDPMTPL VAAFLAEARA IAPHLENDLA       300
     AL                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page