(data stored in ACNUC7421 zone)

EMBL: CP001349.PE252

CP001349.PE252       Location/Qualifiers
FT   CDS             290210..291076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0260"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; KEGG: met:M446_2349
FT                   cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55304"
FT                   /db_xref="GOA:B8I9Q1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q1"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ACL55304.1"
FT                   /translation="MGMARAQHRRFGRSFVGGAAIAAALLTGTAAFAAGTGQPEPWQMD
FT                   LQKPVTEVATEIYNFHHLLNVIMVGIVLLVLVLLLLVIFRFNERSQPNPSRTTHNTILE
FT                   VAWTVVPVLILVAIAIPSFRVLRTQLSDPKADLMVKVIGHAWYWSYEYPQEVGGFKFDA
FT                   NLLEGEDQEKSGQPKLLATDNEMVVPVNKIVKIQVTAADVMHSWAMPSFGFKIDAIPGR
FT                   LNQFWFKAEREGTYHGQCSELCGQRHAYMPITVRVVSDEAFQAWTAEAKTKFARIDTSG
FT                   AKFASAR"
     MGMARAQHRR FGRSFVGGAA IAAALLTGTA AFAAGTGQPE PWQMDLQKPV TEVATEIYNF        60
     HHLLNVIMVG IVLLVLVLLL LVIFRFNERS QPNPSRTTHN TILEVAWTVV PVLILVAIAI       120
     PSFRVLRTQL SDPKADLMVK VIGHAWYWSY EYPQEVGGFK FDANLLEGED QEKSGQPKLL       180
     ATDNEMVVPV NKIVKIQVTA ADVMHSWAMP SFGFKIDAIP GRLNQFWFKA EREGTYHGQC       240
     SELCGQRHAY MPITVRVVSD EAFQAWTAEA KTKFARIDTS GAKFASAR                    288
//

If you have problems or comments...

PBIL Back to PBIL home page