(data stored in ACNUC7421 zone)

EMBL: CP001349.PE253

CP001349.PE253       Location/Qualifiers
FT   CDS             291147..292775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0261"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I; KEGG: met:M446_2348
FT                   cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55305"
FT                   /db_xref="GOA:B8I9Q2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q2"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ACL55305.1"
FT                   /translation="MATAASAGHAEAHDHTPPFFQRWFNSTNHKDIGTLYLLFAFSAGI
FT                   VGAFLSFGIRMEMEQPGLQYFSNPQTYNVFVTGHGLIMVFFMVMPALIGGFGNWFVPLM
FT                   IGAPDMAFPRMNNISFWLTVAGFLSLVCSLFVEGAPGATGPGTGWTVYPPLSTDGHPGP
FT                   AVDFGIFALHLSGAGSILGAINFITTILNMRAPGMTLHKMPLFAWSMLVTAFLLLLSLP
FT                   VLAGAITMLLTDRNFGTTFFSPSGGGDPILYQHLFWFFGHPEVYIMILPAFGIVSHIIS
FT                   TFSRKPIFGYLAMAYAMVAIGVVGFVVWAHHMYTVGLTLQTQSYFVFATMVIAVPTGVK
FT                   IFSWIATMWGGSIRFTAAMHWAVGFVFLFTVGGVTGVILANAAVDRYLHDTYYVVAHFH
FT                   YVLSLGAVFIIFAGVYYWFPKMTGRMIPEWAGKLHFWLAFIGANVLFFPMHFLGLAGMP
FT                   RRYADYPDAFAGWHYVATMGGHVFALGMVVFVIGVVLAFRSKERAADNPWGEGATTLEW
FT                   TLSSPPPFHQYETLPVIVDEPSHAH"
     MATAASAGHA EAHDHTPPFF QRWFNSTNHK DIGTLYLLFA FSAGIVGAFL SFGIRMEMEQ        60
     PGLQYFSNPQ TYNVFVTGHG LIMVFFMVMP ALIGGFGNWF VPLMIGAPDM AFPRMNNISF       120
     WLTVAGFLSL VCSLFVEGAP GATGPGTGWT VYPPLSTDGH PGPAVDFGIF ALHLSGAGSI       180
     LGAINFITTI LNMRAPGMTL HKMPLFAWSM LVTAFLLLLS LPVLAGAITM LLTDRNFGTT       240
     FFSPSGGGDP ILYQHLFWFF GHPEVYIMIL PAFGIVSHII STFSRKPIFG YLAMAYAMVA       300
     IGVVGFVVWA HHMYTVGLTL QTQSYFVFAT MVIAVPTGVK IFSWIATMWG GSIRFTAAMH       360
     WAVGFVFLFT VGGVTGVILA NAAVDRYLHD TYYVVAHFHY VLSLGAVFII FAGVYYWFPK       420
     MTGRMIPEWA GKLHFWLAFI GANVLFFPMH FLGLAGMPRR YADYPDAFAG WHYVATMGGH       480
     VFALGMVVFV IGVVLAFRSK ERAADNPWGE GATTLEWTLS SPPPFHQYET LPVIVDEPSH       540
     AH                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page